
Western blot analysis of extracts of various cell lines.
PTPN11 / SHP-2 / NS1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C332257-20
Catalog Number: LS-C332257
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NS1 antibody LS-C332257 is an unconjugated rabbit polyclonal antibody to NS1 (PTPN11 / SHP-2) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Bptp-3 | BPTP3 | CFC | Csw | Corkscrew csw | Gene corkscrew | Phosphatase corkscrew | PTP-2C | SHP2 | PTP-1D | PTP2C | PTPN11 | SHP-2 | SHPTP2 | Noonan syndrome 1 | SH-PTP2 | SH-PTP3
- UniProt Number
- Q06124
- NCBI GenBank
- NM_002834 | NP_002825.3
- SwissProt
- Q06124
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:100 |
| WB | 1:500 - 1:1000 |
Target
- Target
- Human PTPN11 / SHP-2 / NS1
- Antigen Species
- Human
- Epitope
- Human PTPN11 / SHP-2 / NS1.
- Gene Name
- PTPN11
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 514-593 of human PTPN11 (NP_002825.3). IYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
