PTP4A2 antibody Western blot. All lanes: Anti PTP4A2 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Mouse Brain Tissue Lysate at 50 ug. Lane 4: Mouse Thymus Tissue Lysate at 50 ug. Lane 5: 22RV1 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 19 kD. Observed band size: 19 kD.
PTP4A2 / PRL-2 Antibody (aa40-69)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407952-100
Catalog Number: LS-C407952
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PRL-2 antibody LS-C407952 is an unconjugated rabbit polyclonal antibody to PRL-2 (PTP4A2) (aa40-69) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HH7-2 | HH13 | HU-PP-1 | PRL-2 | PRL2 | Ptp-IV1a | PTPCAAX2 | PTP(CAAXII) | Ptp-IV1b | OV-1 | PTP4A | PTP4A2
- UniProt Number
- Q12974
- NCBI GenBank
- NM_080391
- SwissProt
- Q12974
Target
- Target
- Human PTP4A2 / PRL-2
- Antigen Species
- Human
- Epitope
- Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue. .
- Gene Name
- PTP4A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human PTP4A2 (40-69 aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl