PTHLH / PTHRP Antibody (aa53-86)
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Radioimmunoassay |
| Reactivity: | Dog, Human, Mammal (Other), Mouse, Pig, Rat |
| Format: | Lyophilized |
$470.00each
Catalog Number: LS-C131300-20
Catalog Number: LS-C131300
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PTHRP antibody LS-C131300 is an unconjugated goat polyclonal antibody to PTHRP (PTHLH) (aa53-86) from human. It is reactive with human, mouse, rat and other species. Validated for RIA.
- Application
- RIA
- Reactivity
- Can, Hu, Mml, Ms, Por, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Osteostatin | PTHR | PTH-related protein | PTHLH | PTHRP | BDE2 | HHM | PLP | PTH-rP
- UniProt Number
- P12272
- NCBI GenBank
- NM_002820 | NP_002811.1
- SwissProt
- P12272
Target
- Target
- Human PTHLH / PTHRP
- Antigen Species
- Human
- Epitope
- Recognizes human Parathyroid Hormone related Peptide (aa 53-86).
- Gene Name
- PTHLH
Antibody
- Host Species
- Goat
- Clonality
- Polyclonal
Immunogen
- Immunogen
- Synthetic human PTHrP (aa 53-86) KLH-conjugated(KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Elephant, Panda, Bat, Dog, Pig (100%); Monkey, Sheep, Goat, Hamster, Bovine (97%); Rabbit, Horse (94%); Opossum, Turkey, Chicken (87%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, pH 7.2
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- PBS