
PTH / Parathyroid Hormone Antibody (aa1-38, clone B1/70)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Frozen, Immunohistochemistry, Paraffin, Radioimmunoassay |
| Reactivity: | Human, Non-Human Primate |
| Format: | Lyophilized |
$426.00each
Catalog Number: LS-C122286-10
Catalog Number: LS-C122286
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Parathyroid Hormone antibody LS-C122286 is an unconjugated mouse monoclonal antibody to Parathyroid Hormone (PTH) (aa1-38) from human. It is reactive with human and monkey. Validated for ELISA, ICC, IHC and RIA.
- Application
- ELISA, ICC, IHC, IHC-F, IHC-P, RIA
- Reactivity
- Hu, NHP
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- Parathyroid hormone | Parathyroid hormone 1 | PTH | Parathyrin | Parathormone | PTH1
- Recommended Dilution: ELISA
- 1 ug/ml
- UniProt Number
- P01270
- NCBI GenBank
- NM_000315|NP_000306.1
- SwissProt
- P01270
Target
- Target
- Human PTH / Parathyroid Hormone
- Antigen Species
- Human
- Epitope
- Recognizes human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84;), PTHrP (aa 1-86).
- Gene Name
- PTH
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- B1/70
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from in 50 mM Tris, pH 7.2
- Preservative
- No
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- 50 mm tris
