PTH / Parathyroid Hormone Antibody (aa1-34)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human, Non-Human Primate |
| Format: | Lyophilized |
$493.00each
Catalog Number: LS-C131225-20
Catalog Number: LS-C131225
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Parathyroid Hormone antibody LS-C131225 is an unconjugated rabbit polyclonal antibody to Parathyroid Hormone (PTH) (aa1-34) from human. It is reactive with human and monkey. Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu, NHP
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Parathyroid hormone | Parathyroid hormone 1 | PTH | Parathyrin | Parathormone | PTH1
- Recommended Dilution: ELISA
- 1:3000
- UniProt Number
- P01270
- NCBI GenBank
- NM_000315 | NP_000306.1
- SwissProt
- P01270
Target
- Target
- Human PTH / Parathyroid Hormone
- Antigen Species
- Human
- Epitope
- Recognizes human PTH (aa 15-25; 1-34; 1-38; 1-84; 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-10).
- Gene Name
- PTH
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- Synthetic human PTH (aa 1-34), bTG- conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized. 137mM Mannitol
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized and resuspended forms: store at -20°C. Avoid freeze-thaw cycles.