
Western blot testing of 1) rat kidney, 2) mouse kidney, 3) human HeLa, 4) (h) 22RV1 and 5) (h) HepG2 lysate with PTGS2 antibody at 0.5ug/ml. Predicted molecular weight ~69 kDa.
PTGS2 / COX2 / COX-2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781971-100
Catalog Number: LS-C781971
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- COX-2 antibody LS-C781971 is an unconjugated rabbit polyclonal antibody to COX-2 (PTGS2 / COX2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- COX-2 | Cyclooxygenase-2 | COX2 | Cyclooxygenase 2b | HCox-2 | GRIPGHS | PGH synthase 2 | PGHS-2 | PHS II | PHS-2 | Prostaglandin H2 synthase 2 | PTGS2 | PGG/HS | Prostaglandin G/H synthase 2
- UniProt Number
- P35354
- NCBI GenBank
- NM_000963 | NP_000954.1
- SwissProt
- P35354
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human PTGS2 / COX2 / COX-2
- Antigen Species
- Human
- Gene Name
- PTGS2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 365-397 (AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN) from the human protein were used as the immunogen for the PTGS2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
