Western blot - Anti-PTGS2/Cox 2 Picoband Antibody
PTGS2 / COX2 / COX-2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661918-100
Catalog Number: LS-C661918
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- COX-2 antibody LS-C661918 is an unconjugated mouse monoclonal antibody to human COX-2 (PTGS2 / COX2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- COX-2 | Cyclooxygenase-2 | COX2 | Cyclooxygenase 2b | HCox-2 | GRIPGHS | PGH synthase 2 | PGHS-2 | PHS II | PHS-2 | Prostaglandin H2 synthase 2 | PTGS2 | PGG/HS | Prostaglandin G/H synthase 2
- UniProt Number
- P35354
- NCBI GenBank
- NM_000963 | NP_000954.1
- SwissProt
- P35354
Target
- Target
- Human PTGS2 / COX2 / COX-2
- Antigen Species
- Human
- Gene Name
- PTGS2
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397 aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl