PTGER3 / EP3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408750-20
Catalog Number: LS-C408750
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EP3 antibody LS-C408750 is an unconjugated rabbit polyclonal antibody to EP3 (PTGER3) from human. It is reactive with mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Ep3 prostanoid receptor | Ep3 receptor | EP3-I | EP3e | EP3-II | EP3-III | EP3-IV | PGE receptor, EP3 subtype | Prostaglandin receptor (PGE-2) | Prostaglandin ep3 receptor | Prostanoid EP3 receptor | PTGER3 | PGE receptor EP3 subtype | Pge2 receptor ep3 | PGE2 receptor EP3 subtype | Prostaglandin E receptor 3 | Prostaglandin e2 receptor ep3 | EP3 | Ep3 subtype pge2 receptor | PGE2-R | Prostaglandin E receptor EP3
- Recommended Dilution: IHC
- 1:20 - 1:200
- Recommended Dilution: WB
- 1:200 - 1:2000
- UniProt Number
- P43115
- NCBI GenBank
- NM_000957 | NP_000948.2
- SwissProt
- P43115
Target
- Target
- Human PTGER3 / EP3
- Antigen Species
- Human
- Epitope
- Human PTGER3 / EP3
- Gene Name
- PTGER3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human PTGER3 (NP_942009.1). MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS