
Western blot analysis of extract of various cells.
PTAR2 / FNTA Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410339-20
Catalog Number: LS-C410339
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FNTA antibody LS-C410339 is an unconjugated rabbit polyclonal antibody to FNTA (PTAR2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FNTA | FPTA | FTase-alpha | GGTase-I-alpha | PTAR2 | PGGT1A
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P49354
- NCBI GenBank
- NM_002027 | NP_002018.1
- SwissProt
- P49354
Target
- Target
- Human PTAR2 / FNTA
- Antigen Species
- Human
- Epitope
- Human PTAR2 / FNTA
- Gene Name
- FNTA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 280-379 of human FNTA (NP_002018.1). LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
