Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of 1) rat testis, 2) mouse spleen and 3) human HepG2 lysate with PSMA1 antibody at 0.5ug/ml. Predicted/observed molecular weight ~30 kDa.
PSMA1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781886-100
Catalog Number: LS-C781886
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PSMA1 antibody LS-C781886 is an unconjugated rabbit polyclonal antibody to PSMA1 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 30 kDa prosomal protein | HC2 | Macropain subunit C2 | NU | PSC2 | PSMA1 | PROS30 | Proteasome nu chain | Proteasome subunit alpha 1 | Proteasome subunit nu | Protein P30-33K | Macropain subunit nu | PROS-30 | Proteasome component C2
- UniProt Number
- P25786
- NCBI GenBank
- NM_002786 | NP_002777.1
- SwissProt
- P25786
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human PSMA1
- Antigen Species
- Human
- Gene Name
- PSMA1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 159-204 (MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQD) from the human protein were used as the immunogen for the PSMA1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
