
Western blot testing of 1) human placenta, 2) human U937, 3) rat brain and 4) mouse brain lysate with Properdin antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.
Properdin / CFP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782279-100
Catalog Number: LS-C782279
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CFP antibody LS-C782279 is an unconjugated rabbit polyclonal antibody to CFP (Properdin) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Complement factor P | Complement factor properdin | PFC | PFD | Properidin | BFD | CFP | Properdin | Properdin P factor, complement
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P27918
- NCBI GenBank
- NM_002621 | NP_002612.1
- SwissProt
- P27918
Target
- Target
- Human Properdin / CFP
- Antigen Species
- Human
- Gene Name
- CFP
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR were used as the immunogen for the Properdin antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
