Western blot analysis of extracts of various cell lines, using PRLHR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
PRLHR / GPR10 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C497189-20
Catalog Number: LS-C497189
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GPR10 antibody LS-C497189 is an unconjugated rabbit polyclonal antibody to GPR10 (PRLHR) from human. It is reactive with human and mouse. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- G protein-coupled receptor 10 | G-protein coupled receptor 10 | GPR10 | GR3 | HGR3 | PrRP receptor | PrRPR | Uhr-1 | PRLHR
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- P49683
- NCBI GenBank
- NM_004248 | NP_004239.1
- SwissProt
- P49683
Target
- Target
- Human PRLHR / GPR10
- Antigen Species
- Human
- Gene Name
- PRLHR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRLHR (NP_004239.1). MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS