
Western blot analysis of recombinant human PRL, using anti-PRL antibody (1 :1,000)
PRL / Prolactin Antibody (Preservative Free, Biotin)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$350.00each
Catalog Number: LS-C343439-50
Catalog Number: LS-C343439
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Prolactin antibody LS-C343439 is a biotin-conjugated rabbit polyclonal antibody to human Prolactin (PRL). Validated for ELISA and WB.
- Application
- ELISA, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Decidual prolactin | PRL | Prolactin
- Recommended Dilution: ELISA
- 1:64000
- Recommended Dilution: WB
- 1:1000
- UniProt Number
- P01236
- NCBI GenBank
- NM_000948 | NP_000939.1
- SwissProt
- P01236
Target
- Target
- Human PRL / Prolactin
- Antigen Species
- Human
- Epitope
- This antibody can specifically bind to human prolactin. The cross reactivity with mouse and rat prolactin was not tested.
- Gene Name
- PRL
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- KLH-conjugated synthetic peptide (prolactin). Immunogen Sequence: CKENEIYPVWSGLPSLQMADEESRLSAYYN.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Biotin
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, No preservatives added
- Preservative
- No
- Purification Method
- Protein G Affinity
Storage & Handling
- Storage Conditions
- Short term: Store at 4 °C for 1 month. Long term: Store at -20°C to -70°C for up to 1 year. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
