
Flow Cytometry analysis of PC-3 cells using anti-AMPK beta 2 antibody. Overlay histogram showing PC-3 cells stained with anti-AMPK beta 2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-AMPK beta 2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PRKAB2 / AMPK Beta 2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Frozen, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756673-100
Catalog Number: LS-C756673
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AMPK Beta 2 antibody LS-C756673 is an unconjugated mouse monoclonal antibody to human AMPK Beta 2 (PRKAB2). Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC-F, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- AMPK beta-2 chain | PRKAB2 | AMPK beta 2 | AMPK subunit beta-2
- UniProt Number
- O43741
- NCBI GenBank
- NM_005399 | NP_005390.1
- SwissProt
- O43741
Recommended Dilution
| Application | Dilution |
|---|---|
| FC | 1 - 3 µg/10E6 cells |
| IF/ICC | 0.5 - 1 µg/ml |
| IHC-F | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human PRKAB2 / AMPK Beta 2
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- PRKAB2
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG2b
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human AMPK beta 2 (56-89 aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
