
Immunohistochemistry of paraffin-embedded human esophagus using PRKAB1 antibody at dilution of 1:100 (40x lens).
PRKAB1 / AMPK Beta 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$293.00each
Catalog Number: LS-C747591-20
Catalog Number: LS-C747591
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AMPK Beta 1 antibody LS-C747591 is an unconjugated rabbit polyclonal antibody to human AMPK Beta 1 (PRKAB1). Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMPK beta 1 | AMPK subunit beta-1 | AMPKb | PRKAB1 | AMPK | AMPK beta -1 chain | HAMPKb
- UniProt Number
- Q9Y478
- NCBI GenBank
- NM_006253 | NP_006244.2
- SwissProt
- Q9Y478
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human PRKAB1 / AMPK Beta 1
- Antigen Species
- Human
- Gene Name
- PRKAB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human PRKAB1 (NP_006244.2). MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPT
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
