Western blot analysis of extracts of various cell lines, using PPP2R2B antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

PPP2R2B Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C497203-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PPP2R2B antibody LS-C497203 is an unconjugated rabbit polyclonal antibody to PPP2R2B from human. It is reactive with human, mouse and rat. Validated for WB.
Application: IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: B55BETA | PP2ABBETA | PP2APR55BETA | PP2A subunit B isoform beta | PR2AB55BETA | PR55-BETA | SCA12 | Spinocerebellar ataxia 12 | PP2A subunit B isoform R2-beta | PP2AB55BETA | PP2APR55B | PR55BETA | PPP2R2B | PR2ABBETA | PR2APR55BETA | PR52B
Recommended Dilution: WB: 1:1000 - 1:2000
UniProt Number: Q00005
NCBI GenBank: NM_004576 | NP_004567.1
SwissProt: Q00005

Target

Target: Human PPP2R2B
Antigen Species: Human
Gene Name: PPP2R2B

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human PPP2R2B (NP_858060.2). KIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDL
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)