PPP1R12A antibody Western blot. All lanes: Anti PPP1R12A at 0.5 ug/ml. Lane 1: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 150 kD. Observed band size: 150 kD.
PPP1R12A / MYPT1 Antibody (aa1-40)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407949-100
Catalog Number: LS-C407949
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MYPT1 antibody LS-C407949 is an unconjugated rabbit polyclonal antibody to MYPT1 (PPP1R12A) (aa1-40) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Hr, Hu, Mml, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- M130 | PPP1R12A | MYPT1 | MBS | Myosin binding subunit
- UniProt Number
- O14974
- NCBI GenBank
- NM_002480 | NP_002471.1
- SwissProt
- O14974
Target
- Target
- Human PPP1R12A / MYPT1
- Antigen Species
- Human
- Epitope
- Expressed in striated muscles, specifically in type 2a fibers (at protein level). .
- Gene Name
- PPP1R12A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human PPP1R12A (1-40 aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl