Immunohistochemistry - Anti-ACTH Picoband Antibody
POMC / Proopiomelanocortin Antibody (aa138-176)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Human, Non-Human Primate |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C313433-100
Catalog Number: LS-C313433
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Proopiomelanocortin antibody LS-C313433 is an unconjugated rabbit polyclonal antibody to Proopiomelanocortin (POMC) (aa138-176) from human. It is reactive with human and monkey. Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Hu, NHP
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Alpha-MSH | ACTH | Adrenocorticotropin | Adrenocorticotropic hormone | Beta-LPH | CLIP | Gamma-MSH | Lipotropin gamma | LPH | Melanotropin alpha | Met-enkephalin | Melanotropin beta | NPP | POMC | Pro-ACTH-endorphin | Lipotropin beta | Melanotropin gamma | MSH | Proopiomelanocortin | Beta-endorphin | Beta-MSH | Gamma-LPH | POC | Pro-opiomelanocortin
- UniProt Number
- P01189
- NCBI GenBank
- NM_000939 | NP_000930.1
- SwissProt
- P01189
Target
- Target
- Human POMC / Proopiomelanocortin
- Antigen Species
- Human
- Epitope
- ACTH and MSH are produced by the pituitary gland.
- Gene Name
- POMC
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176 aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl