Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Polyclonal Rabbit anti-Rat MAPK3 / ERK1 Antibody (aa372-406, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Functional Assay, Immunoprecipitation, Western Blot |
| Reactivity: | Hamster, Mouse, Rabbit, Rat |
| Format: | Liquid |
$648.00each
Catalog Number: LS-C16368-100
Catalog Number: LS-C16368
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ERK1 antibody LS-C16368 is an unconjugated rabbit polyclonal antibody to ERK1 (MAPK3) (aa372-406) from rat. It is reactive with mouse, rat, hamster and other species. Validated for Func, IP and WB.
- Application
- Func, IP, WB
- Reactivity
- Ham, Ms, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ERK-1 | ERT2 | HUMKER1A | HS44KDAP | MAP kinase 1 | MAP kinase isoform p44 | MAPK 1 | MAPK 3 | p44 | p44MAPK | p44-MAPK | p44ERK1 | MAP kinase 3 | p44-ERK1 | ERK1 | MAPK3 | PRKM3
- UniProt Number
- P27361
- NCBI GenBank
- CAA42744.1|X60188
- SwissProt
- P27361
Target
- Target
- Rat MAPK3 / ERK1
- Antigen Species
- Rat
- Epitope
- Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35.
- Gene Name
- MAPK3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-Terminus 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- 0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 0.1 mM EDTA.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- 0.2 M Tris-glycine|0.15 M sodium chloride
