Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot testing of 1) rat brain, 2) rat lung, 3) mouse stomach and 4) mouse kidney lysate with GSTM1 antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.
Polyclonal Rabbit anti-Mouse GSTM1 Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782843-100
Catalog Number: LS-C782843
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GSTM1 antibody LS-C782843 is an unconjugated rabbit polyclonal antibody to GSTM1 from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Glutathione S-aryltransferase | GSTM1-1 | GSTM1a-1a | GSTM1b-1b | Glutathione S-alkyltransferase | GTH4 | GST class-mu 1 | GST1 | GTM1 | H-B | HB subunit 4 | MU-1 | Glutathione S-transferase M1 | Glutathione S-transferase mu 1 | GST HB subunit 4 | GSTM1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P09488
- NCBI GenBank
- NM_000561 | NP_000552.2
- SwissProt
- P09488
Target
- Target
- Mouse GSTM1
- Antigen Species
- Mouse
- Gene Name
- GSTM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK from the human protein were used as the immunogen for the GSTM1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
