Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
anti-Wnt7a antibody, Western blotting All lanes: Anti Wnt7a at 0.5ug/ml WB: HELA Whole Cell Lysate at 40ug Predicted bind size: 39KD Observed bind size: 39KD
Polyclonal Rabbit anti-Human WNT7A Antibody (aa226-256, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Dog, Guinea Pig, Hamster, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408143-100
Catalog Number: LS-C408143
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- WNT7A antibody LS-C408143 is an unconjugated rabbit polyclonal antibody to WNT7A (aa226-256) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Can, GP, Ham, Hr, Hu, Ms, Por, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Protein Wnt-7a | Proto-oncogene Wnt7a protein | WNT7A
- UniProt Number
- O00755
- NCBI GenBank
- NM_004625 | NP_004616.2
- SwissProt
- O00755
Target
- Target
- Human WNT7A
- Antigen Species
- Human
- Epitope
- Expression is restricted to placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain.
- Gene Name
- WNT7A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Wnt7a (226-256 aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
