Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot - Anti-Beta III Tubulin Picoband Antibody. Lane 1, rat brain extract; Lane 2, mouse brain extract; and Lane 3, HeLa cell extracts.
Polyclonal Rabbit anti-Human TUBB / Beta Tubulin Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662122-100
Catalog Number: LS-C662122
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Beta Tubulin antibody LS-C662122 is an unconjugated rabbit polyclonal antibody to Beta Tubulin (TUBB) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Beta Tubulin | Beta 5-tubulin | Beta-4 tubulin | Beta1-tubulin | M40 | TUBB | Tubulin beta-5 chain | Beta Ib tubulin | Class I beta-tubulin | OK/SW-cl.56 | TUBB5 | Tubulin beta chain | Tubulin beta polypeptide | Tubulin beta-1 chain | Tubulin, beta class I | Tubulin, beta polypeptide
- Recommended Dilution: IHC-P
- 1:100
- UniProt Number
- P07437
- NCBI GenBank
- NM_178014 | NP_821133.1
- SwissProt
- P07437
Target
- Target
- Human TUBB / Beta Tubulin
- Antigen Species
- Human
- Epitope
- Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues. .
- Gene Name
- TUBB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Beta III Tubulin (383-412 aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
