Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
SULT2A1 antibody Western blot. All lanes: Anti SULT2A1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: Mouse Kidney Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 34 kD. Observed band size: 34 kD.
Polyclonal Rabbit anti-Human SULT2A1 / Sulfotransferase 2A1 Antibody (aa253-285, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408032-100
Catalog Number: LS-C408032
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Sulfotransferase 2A1 antibody LS-C408032 is an unconjugated rabbit polyclonal antibody to Sulfotransferase 2A1 (SULT2A1) (aa253-285) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Alcohol sulfotransferase | Bile salt sulfotransferase | DHEA-ST | DHEAS | Hst | HSTa | ST2 | STD | SULT2A1 | ST2A3 | ST2A1 | Sulfotransferase 2A1
- UniProt Number
- Q06520
- NCBI GenBank
- NM_003167 | NP_003158.2
- SwissProt
- Q06520
Target
- Target
- Human SULT2A1 / Sulfotransferase 2A1
- Antigen Species
- Human
- Epitope
- Liver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney.
- Gene Name
- SULT2A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SULT2A1 (253-285 aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
