Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Immunohistochemistry of paraffin-embedded rat ovary using S100A10 antibody at dilution of 1:100 (40x lens).
Polyclonal Rabbit anti-Human S100A10 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749651-20
Catalog Number: LS-C749651
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- S100A10 antibody LS-C749651 is an unconjugated rabbit polyclonal antibody to S100A10 from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, NHP, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 42C | ANX2LG | Calpactin-1 light chain | Calpactin I light chain | CLP11 | p11 | p10 | p10 protein | S100A10 | Protein S100-A10 | ANX2L | Ca[1] | CAL1L | Cellular ligand of annexin II | gp11
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P60903
- NCBI GenBank
- NM_002966 | NP_002957.1
- SwissProt
- P60903
Target
- Target
- Human S100A10
- Antigen Species
- Human
- Gene Name
- S100A10
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1). MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 0.47 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
