Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
RENT1/hUPF1 antibody Western blot. All lanes: Anti RENT1/hUPF1 at 0.5 ug/ml. Lane 1: Rat Pancreas Tissue Lysate at 50 ug. Lane 2: PANC Whole Cell Lysate at 40 ug. Predicted band size: 140 kD. Observed band size: 140 kD.
Polyclonal Rabbit anti-Human RENT1 / UPF1 Antibody (aa578-614, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Chicken, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408053-100
Catalog Number: LS-C408053
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UPF1 antibody LS-C408053 is an unconjugated rabbit polyclonal antibody to UPF1 (RENT1) (aa578-614) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Ck, GP, Ham, Hr, Hu, Mml, Ms, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Delta helicase | HUPF1 | PNORF1 | KIAA0221 | UP Frameshift 1 | UPF1 | Yeast Upf1p homolog | ATP-dependent helicase RENT1 | NORF1 | RENT1 | Smg-2
- UniProt Number
- Q92900
- NCBI GenBank
- NM_002911 | NP_002902.2
- SwissProt
- Q92900
Target
- Target
- Human RENT1 / UPF1
- Antigen Species
- Human
- Epitope
- Ubiquitous.
- Gene Name
- UPF1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614 aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
