Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
AMPK beta 2 antibody Western blot. All lanes: Anti AMPK beta 2 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 3: PANC Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 30 kD.
Polyclonal Rabbit anti-Human PRKAB2 / AMPK Beta 2 Antibody (aa56-89, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Horse, Human, Mammal (Other), Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407951-100
Catalog Number: LS-C407951
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AMPK Beta 2 antibody LS-C407951 is an unconjugated rabbit polyclonal antibody to AMPK Beta 2 (PRKAB2) (aa56-89) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hr, Hu, Mml, Ms, Por, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMPK beta-2 chain | PRKAB2 | AMPK beta 2 | AMPK subunit beta-2
- UniProt Number
- O43741
- NCBI GenBank
- NM_005399, NP_005390.1
- SwissProt
- O43741
Target
- Target
- Human PRKAB2 / AMPK Beta 2
- Antigen Species
- Hu
- Gene Name
- PRKAB2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human AMPK beta 2 (56-89 aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
