Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Polyclonal Rabbit anti-Human PRKAB1 / AMPK Beta 1 Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490412-100
Catalog Number: LS-C490412
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AMPK Beta 1 antibody LS-C490412 is an unconjugated rabbit polyclonal antibody to human AMPK Beta 1 (PRKAB1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMPK beta 1 | AMPK subunit beta-1 | AMPKb | PRKAB1 | AMPK | AMPK beta -1 chain | HAMPKb
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q9Y478
- NCBI GenBank
- NM_006253 | NP_006244.2
- SwissProt
- Q9Y478
Target
- Target
- Human PRKAB1 / AMPK Beta 1
- Antigen Species
- Human
- Gene Name
- PRKAB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE of human AMPK beta 1 were used as the immunogen for the PRKAB1 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
