Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Peroxiredoxin 4 antibody Western blot. All lanes: Anti Peroxiredoxin 4 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
Polyclonal Rabbit anti-Human PRDX4 / Peroxiredoxin 4 Antibody (aa178-2081, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Horse, Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357571-100
Catalog Number: LS-C357571
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Peroxiredoxin 4 antibody LS-C357571 is an unconjugated rabbit polyclonal antibody to Peroxiredoxin 4 (PRDX4) (aa178-2081) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB.
- Application
- ICC, IHC, IHC-P, WB
- Reactivity
- Hr, Hu, Ms, NHP, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Antioxidant enzyme AOE372 | AOE37-2 | Peroxiredoxin IV | PRDX4 | Prx-IV | Thioredoxin peroxidase AO372 | Peroxiredoxin-4 | PRX-4 | Peroxiredoxin 4
- UniProt Number
- Q13162
- NCBI GenBank
- NM_006406, NP_006397.1
- SwissProt
- Q13162
Target
- Target
- Human PRDX4 / Peroxiredoxin 4
- Antigen Species
- Hu
- Gene Name
- PRDX4
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Peroxiredoxin 4 (178-2081 aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
