Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
PPT1 antibody Western blot. All lanes: Anti PPT1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: 22RV1 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: A431 Whole Cell Lysate at 40 ug. Lane 6: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 34 kD. Observed band size: 34 kD.
Polyclonal Rabbit anti-Human PPT1 / CLN1 Antibody (aa191-224, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407993-100
Catalog Number: LS-C407993
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CLN1 antibody LS-C407993 is an unconjugated rabbit polyclonal antibody to CLN1 (PPT1) (aa191-224) from human. It is reactive with human and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CLN1 | Palmitoyl-protein hydrolase 1 | Palmitoyl-protein thioesterase | INCL | PPT-1 | PPT1 | PPT
- UniProt Number
- P50897
- NCBI GenBank
- NM_000310, NP_000301.1
- SwissProt
- P50897
Target
- Target
- Human PPT1 / CLN1
- Antigen Species
- Hu
- Gene Name
- PPT1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PPT1 (191-224 aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
