Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
PGRMC1 antibody Western blot. All lanes: Anti PGRMC1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: Mouse Kidney Tissue Lysate at 50 ug. Lane 5: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 26 kD. Observed band size: 26 kD.
Polyclonal Rabbit anti-Human PGRMC1 / MPR Antibody (aa67-102, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407987-100
Catalog Number: LS-C407987
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MPR antibody LS-C407987 is an unconjugated rabbit polyclonal antibody to MPR (PGRMC1) (aa67-102) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Hr, Hu, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HPR6.6 | PGRMC1 | Progesterone binding protein | MPR | PGRMC
- UniProt Number
- O00264
- NCBI GenBank
- NM_006667 | NP_006658.1
- SwissProt
- O00264
Target
- Target
- Human PGRMC1 / MPR
- Antigen Species
- Human
- Epitope
- Widely expressed, with highest expression in liver and kidney.
- Gene Name
- PGRMC1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102 aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
