Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot testing of 1) HEK293, 2) HK-2, 3) SGC-7901, 4) rat brain and 5) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
Polyclonal Rabbit anti-Human MOG Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782266-100
Catalog Number: LS-C782266
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MOG antibody LS-C782266 is an unconjugated rabbit polyclonal antibody to MOG from human. It is reactive with human, mouse and rat. Validated for Flow, IHC and WB.
- Application
- FC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- MOG | NRCLP7 | MOGIG2 | MOG alpha-5 | MOG Ig-AluB
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q16653
- NCBI GenBank
- NM_002433 | NP_002424.3
- SwissProt
- Q16653
Target
- Target
- Human MOG
- Antigen Species
- Human
- Gene Name
- MOG
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
