Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
SAPK4 antibody Western blot. All lanes: Anti SAPK4 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 42 kD. Observed band size: 42 kD.
Polyclonal Rabbit anti-Human MAPK13 / p38delta Antibody (aa332-365, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407933-100
Catalog Number: LS-C407933
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P38delta antibody LS-C407933 is an unconjugated rabbit polyclonal antibody to p38delta (MAPK13) (aa332-365) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- MAPK-13 | MAPK 13 | MAPK13 | p38delta | PRKM13 | SAPK4 | Serk 4 | MAP kinase 13 | MAP kinase p38 delta
- UniProt Number
- O15264
- NCBI GenBank
- NM_002754 | NP_002745.1
- SwissProt
- O15264
Target
- Target
- Human MAPK13 / p38delta
- Antigen Species
- Human
- Epitope
- Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. .
- Gene Name
- MAPK13
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SAPK4 (332-365 aa KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
