Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Ikaros antibody Western blot. All lanes: Anti Ikaros at 0.5 ug/ml. WB: HELA Whole Cell Lysate at 40 ug. Predicted band size: 58 kD. Observed band size: 58 kD.
Polyclonal Rabbit anti-Human IKZF1 / IKAROS Antibody (aa428-459, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407855-100
Catalog Number: LS-C407855
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IKAROS antibody LS-C407855 is an unconjugated rabbit polyclonal antibody to IKAROS (IKZF1) (aa428-459) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CLL-associated antigen KW-6 | HIk-1 | Hs.54452 | IK1 | IKAROS | Ikaros/lyf-1 homolog | LyF-1 | IKZF1 | PRO0758 | DNA-binding protein Ikaros | Ikaros (zinc finger protein) | LYF1 | ZNFN1A1
- UniProt Number
- Q13422
- NCBI GenBank
- NM_006060, NP_006051.1
- SwissProt
- Q13422
Target
- Target
- Human IKZF1 / IKAROS
- Antigen Species
- Hu
- Epitope
- Abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. Lower expression in bone marrow and small intestine. .
- Gene Name
- IKZF1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Ikaros (428-459 aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
