Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of various cell lines.
Polyclonal Rabbit anti-Human HSPE1 / HSP10 / Chaperonin 10 Antibody (IHC, IF, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C349143-20
Catalog Number: LS-C349143
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Chaperonin 10 antibody LS-C349143 is an unconjugated rabbit polyclonal antibody to Chaperonin 10 (HSPE1 / HSP10) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 10 kd chaperonin | 10 kDa chaperonin | Chaperonin 10 | CPN10 | Early-pregnancy factor | EPF | GROES | HSPE1 | HSP10
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P61604
- NCBI GenBank
- NM_002157 | NP_002148.1
- SwissProt
- P61604
Target
- Target
- Human HSPE1 / HSP10 / Chaperonin 10
- Antigen Species
- Human
- Epitope
- Human HSPE1 / HSP10 / Chaperonin 10
- Gene Name
- HSPE1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human HSPE1 (NP_002148.1). MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
