Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Polyclonal Rabbit anti-Human HMOX1 / HO-1 Antibody (aa1-30, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunoprecipitation, Western Blot |
| Reactivity: | Human, Mammal (Other) |
| Format: | Liquid |
$589.00each
Catalog Number: LS-C15741-50
Catalog Number: LS-C15741
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HO-1 antibody LS-C15741 is an unconjugated rabbit polyclonal antibody to HO-1 (HMOX1) (aa1-30) from human. It is reactive with human and bat. Validated for IP and WB.
- Application
- IP, WB
- Reactivity
- Hu, Mml
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BK286B10 | HO-1 | HSP32 | HMOX1 | Heat shock protein, 32-kD | Heme oxygenase (decycling) 1 | Heme oxygenase 1 | HO1
- Recommended Dilution: IP
- 1:100
- Recommended Dilution: WB
- 1:2500
- UniProt Number
- P09601
- NCBI GenBank
- NM_002133|NP_002124.1
- SwissProt
- P09601
Target
- Target
- Human HMOX1 / HO-1
- Antigen Species
- Human
- Epitope
- Identifies purified rat HO-1 protein and will detect an ~32kD protein, corresponding to the apparent molecular mass of heme-oxygenase-1 on SDS-PAGE immunoblot. Species cross-reactivity: human, mouse, rat, canine, monkey, rabbit and hamster. Does not detect heme-oxygenase-2.
- Gene Name
- HMOX1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to aa1-30 of human HO-1 prepared as a four branched multiple antigen peptide. Percent identity by BLAST analysis: Human, Orangutan, Gibbon, Marmoset, Bat (100%); Monkey, Mouse (97%); Elephant (90%); Rat, Pig (87%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, 0.09% Sodium Azide, 50% Glycerol
- Preservative
- Yes
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
