Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Hex antibody Western blot. All lanes: Anti Hex at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPG Whole Cell Lysate at 40 ug. Predicted band size: 47 kD. Observed band size: 47 kD.
Polyclonal Rabbit anti-Human HHEX / HEX Antibody (aa146-180, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Xenopus, Zebrafish |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407843-100
Catalog Number: LS-C407843
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HEX antibody LS-C407843 is an unconjugated rabbit polyclonal antibody to HEX (HHEX) (aa146-180) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Xen, Zf
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HEX | HMPH | HHEX | Homeobox protein HEX | HOX11L-PEN | PRHX | Homeobox protein PRH | PRH
- UniProt Number
- P43120
- SwissProt
- P43120
Target
- Target
- Human HHEX / HEX
- Antigen Species
- Hu
- Epitope
- Liver and promyelocytic leukemia cell line HL- 60. .
- Gene Name
- Hhex
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180 aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
