Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot - Anti-Connexin 45/GJA7 Picoband Antibody
Polyclonal Rabbit anti-Human GJC1 / CX45 / Connexin 45 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662263-100
Catalog Number: LS-C662263
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Connexin 45 antibody LS-C662263 is an unconjugated rabbit polyclonal antibody to human Connexin 45 (GJC1 / CX45). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Connexin-45 | Connexin 45 | Gap junction alpha-7 protein | GJC1 | Gap junction gamma-1 protein | CX45 | Gap junction protein alpha-6 | GJA7
- UniProt Number
- P36383
- NCBI GenBank
- NM_005497 | NP_005488.2
- SwissProt
- P36383
Target
- Target
- Human GJC1 / CX45 / Connexin 45
- Antigen Species
- Human
- Gene Name
- GJC1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Connexin 45/GJA7 (91-131 aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
