Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot - Anti-FZD3/Frizzled 3 antibody
Polyclonal Rabbit anti-Human FZD3 / Frizzled 3 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662789-100
Catalog Number: LS-C662789
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Frizzled 3 antibody LS-C662789 is an unconjugated rabbit polyclonal antibody to human Frizzled 3 (FZD3). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Frizzled family receptor 3 | FZD3 | Frizzled 3 | HFz3 | Frizzled homolog 3 | Fz-3 | Wnt receptor frizzled-3 | Frizzled-3
- UniProt Number
- Q9NPG1
- NCBI GenBank
- NM_017412 | NP_059108.1
- SwissProt
- Q9NPG1
Target
- Target
- Human FZD3 / Frizzled 3
- Antigen Species
- Human
- Epitope
- Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.
- Gene Name
- FZD3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
