Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of mouse heart cells.
Polyclonal Rabbit anti-Human ESRRB / ERR Beta Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409951-20
Catalog Number: LS-C409951
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ERR Beta antibody LS-C409951 is an unconjugated rabbit polyclonal antibody to mouse ERR Beta (ESRRB). Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DFNB35 | ERRb | ERRbeta-2 | ESRL2 | Estrogen receptor-like 2 | ERR-beta | ERRB2 | ERRbeta | NR3B2 | Nuclear receptor ERRB2 | Orphan nuclear receptor | ERR beta-2 | ERR2 | ESRRB | Estrogen-related receptor 2 | Estrogen-related receptor beta | Steroid hormone receptor ERR2
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O95718
- NCBI GenBank
- NM_004452 | NP_004443.3
- SwissProt
- O95718
Target
- Target
- Human ESRRB / ERR Beta
- Antigen Species
- Human
- Epitope
- Human ESRRB / ERR Beta
- Gene Name
- ESRRB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3). GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
