Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Eph receptor B1 antibody Western blot. All lanes: Anti Eph receptor B1 at 0.5 ug/ml. WB: 293T Whole Cell Lysate at 40 ug. Predicted band size: 111 kD. Observed band size: 111 kD.
Polyclonal Rabbit anti-Human EPHB1 / EPH Receptor B1 Antibody (aa56-88, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Chicken, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407798-100
Catalog Number: LS-C407798
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EPH Receptor B1 antibody LS-C407798 is an unconjugated rabbit polyclonal antibody to EPH Receptor B1 (EPHB1) (aa56-88) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Ck, GP, Hr, Hu, Mml, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cek6 | EK6 | EPHB1 | ELK | Ephrin type-B receptor 1 | Hek6 | EPHT2 | NET | EPH receptor B1 | EPH tyrosine kinase 2 | EPH-like kinase 6 | Soluble EPHB1 variant 1
- UniProt Number
- P54762
- NCBI GenBank
- NM_004441 | NP_004432.1
- SwissProt
- P54762
Target
- Target
- Human EPHB1 / EPH Receptor B1
- Antigen Species
- Human
- Epitope
- Preferentially expressed in brain.
- Gene Name
- EPHB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Eph receptor B1 (56-88 aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
Anti-Myelin Proteolipid Protein Peptide Monoclonal Antibodies Recognize Cell Surface Proteins on Developing Neurons and Inhibit Their Differentiation. Sobel RA, Eaton MJ, Jaju PD, Lowry E, Hinojoza JR. Journal of neuropathology and experimental neurology. 2019 September;78:819-843. PubMed: 31400116 PMC: PMC6703999
