Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
CRY2 antibody Western blot. All lanes: Anti CRY2 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Brain Tissue Lysate at 50 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 67 kD.
Polyclonal Rabbit anti-Human CRY2 Antibody (aa171-200, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407789-100
Catalog Number: LS-C407789
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CRY2 antibody LS-C407789 is an unconjugated rabbit polyclonal antibody to CRY2 (aa171-200) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cryptochrome-2 | CRY2 | KIAA0658 | Growth-inhibiting protein 37 | Photolyase-like 2 | PHLL2 | HCRY2
- UniProt Number
- Q49AN0
- NCBI GenBank
- NM_021117, NP_066940.2
- SwissProt
- Q49AN0
Target
- Target
- Human CRY2
- Antigen Species
- Hu
- Epitope
- Expressed in all tissues examined including fetal brain, fibroblasts, heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Highest levels in heart and skeletal muscle. .
- Gene Name
- CRY2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human CRY2 (171-200 aa RFQAIISRMELPKKPVGLVTSQQMESCRAE), different from the related mouse and rat sequences by five amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
