Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
IHC testing of FFPE human intestinal cancer tissue with DC-SIGN antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
Polyclonal Rabbit anti-Human CD209 / DC-SIGN Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782089-100
Catalog Number: LS-C782089
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- DC-SIGN antibody LS-C782089 is an unconjugated rabbit polyclonal antibody to human DC-SIGN (CD209). Validated for Flow, IHC and WB. Cited in 1 publication.
- Application
- FC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD209 antigen | CD209 molecule | CDSIGN | CLEC4L | CD209 | DC-SIGN | HIV gpl20-binding protein | DC-SIGN1
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q9NNX6
- NCBI GenBank
- NM_021155 | NP_066978.1
- SwissProt
- Q9NNX6
Target
- Target
- Human CD209 / DC-SIGN
- Antigen Species
- Human
- Gene Name
- CD209
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
Single-cell RNA sequencing uncovers the individual alteration of intestinal mucosal immunocytes in Dusp6 knockout mice. Cherng-Shyang Chang, Wen-Hsuan Yu, Chang-Chao Su, Jhen-Wei Ruan, Chiao-Mei Lin, Chih-Ting Huang, Yi-Ting Tsai, I-Jung Lin, Chao-Yang Lai, Tsung-Hsien Chuang, Wen-Jye Lin, Tse-Hua Tan, Hsuan-Cheng Huang, Hsueh-Fen Juan, Cheng-Yuan Kao. iScience. 2022 February;25:103738. PubMed: 35128351 PMC: PMC8800014
