Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of various cell lines.
Polyclonal Rabbit anti-Human CCL3 / MIP-1-Alpha Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C349251-20
Catalog Number: LS-C349251
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MIP-1-Alpha antibody LS-C349251 is an unconjugated rabbit polyclonal antibody to MIP-1-Alpha (CCL3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-C motif chemokine 3 | CCL3 | G0S19-1 | Mip1alpha | SCYA3 | SIS-beta | Chemokine (C-C motif) ligand 3 | LD78ALPHA | MIP-1-alpha | MIP1A | PAT 464.1 | Small-inducible cytokine A3
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- NCBI GenBank
- NM_002983 | NP_002974.1
Target
- Target
- Human CCL3 / MIP-1-Alpha
- Antigen Species
- Human
- Epitope
- Human CCL3 / MIP-1-Alpha
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human CCL3 (NP_002974.1). SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
