Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
ATX2 antibody Western blot. All lanes: Anti ATX2 at 0.5 ug/ml. WB: Mouse Liver Tissue Lysate at 50 ug. Predicted band size: 140 kD. Observed band size: 140 kD.
Polyclonal Rabbit anti-Human ATXN2 / SCA2 / Ataxin-2 Antibody (aa1283-1313, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407696-100
Catalog Number: LS-C407696
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Ataxin-2 antibody LS-C407696 is an unconjugated rabbit polyclonal antibody to Ataxin-2 (ATXN2 / SCA2) (aa1283-1313) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ASL13 | Ataxin 2 | ATX2 | Ataxin-2 | SCA2 | TNRC13 | ATXN2
- UniProt Number
- Q99700
- NCBI GenBank
- NM_002973 | NP_002964.3
- SwissProt
- Q99700
Target
- Target
- Human ATXN2 / SCA2 / Ataxin-2
- Antigen Species
- Human
- Epitope
- Expressed in the brain, heart, liver, skeletal muscle, pancreas and placenta. Isoform 1 is predominant in the brain and spinal cord. Isoform 4 is more abundant in the cerebellum. In the brain, broadly expressed in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus. .
- Gene Name
- ATXN2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ATX2 (1283-1313 aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
