Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
APLP1 antibody Western blot. All lanes: Anti APLP1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 72 kD. Observed band size: 85 kD.
Polyclonal Rabbit anti-Human APLP1 / APLP-1 Antibody (aa82-112, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Horse, Human, Mouse, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407690-100
Catalog Number: LS-C407690
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- APLP-1 antibody LS-C407690 is an unconjugated rabbit polyclonal antibody to APLP-1 (APLP1) (aa82-112) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hr, Hu, Ms, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- APLP-1 | APLP1 | APLP | Amyloid-like protein 1
- UniProt Number
- P51693
- NCBI GenBank
- NM_005166 | NP_005157.1
- SwissProt
- P51693
Target
- Target
- Human APLP1 / APLP-1
- Antigen Species
- Human
- Epitope
- Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). .
- Gene Name
- APLP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human APLP1 (82-112 aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
