Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot - Anti-ANGPTL3 Picoband antibody
Polyclonal Rabbit anti-Human ANGPTL3 Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662762-100
Catalog Number: LS-C662762
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ANGPTL3 antibody LS-C662762 is an unconjugated rabbit polyclonal antibody to human ANGPTL3. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ANGPT5 | ANG-5 | Angiopoietin-5 | Angiopoietin-like 3 | Angiopoietin-related protein 3 | FHBL2 | Angiopoietin 5 | Angiopoietin-like protein 3 | ANGPTL3
- UniProt Number
- Q9Y5C1
- NCBI GenBank
- NM_014495 | NP_055310.1
- SwissProt
- Q9Y5C1
Target
- Target
- Human ANGPTL3
- Antigen Species
- Human
- Epitope
- Expressed principally in liver. Weakly expressed in kidney. Binds to adipocytes. Increased expression and colocalization with activated ITGB3 in glomeruli of patients with nephrotic syndrome showing effaced podocyte foot processes (at protein level).
- Gene Name
- ANGPTL3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human ANGPTL3 (RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
