Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot testing of RUNX1 antibody and recombinant human protein (0.5ng)
Polyclonal Rabbit anti-Human AML1 / RUNX1 Antibody (aa227-257, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Hamster, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C389189-100
Catalog Number: LS-C389189
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RUNX1 antibody LS-C389189 is an unconjugated rabbit polyclonal antibody to RUNX1 (AML1) (aa227-257) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Ham, Hr, Hu, Ms, Por, Rb, Rt, Sh
- Predicted Reactivity
- Chicken, Guinea Pig
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMLCR1 | Aml1 oncogene | AML1 | AML1-EVI-1 | CBF-alpha-2 | CBFA2 | Acute myeloid leukemia 1 | EVI-1 | PEBP2A2 | PEA2-alpha B | AML1-EVI-1 fusion protein | Oncogene AML-1 | PEBP2-alpha B | PEBP2aB | RUNX1
- UniProt Number
- Q01196
- NCBI GenBank
- NM_001754 | NP_001745.2
- SwissProt
- Q01196
Target
- Target
- Human AML1 / RUNX1
- Antigen Species
- Human
- Epitope
- Human AML1 / RUNX1
- Gene Name
- RUNX1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Bovine, Hamster, Rabbit, Horse, Pig, Zebra finch, Dog (100%); Chicken (97%); Opossum, Guinea pig, Platypus, Lizard (90%); Elephant (84%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
