Polyclonal Goat anti-Goat Biotin Antibody (FITC, IF)
Catalog Number: LS-C758060-1
1 mg / $322.00
Antibody: Goat Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunofluorescence
Reactivity: Goat
Format: Liquid
Polyclonal Goat anti-Human Insulin Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Western Blot |
| Format: | Liquid |
$431.00each
Catalog Number: LS-C757175-600
Catalog Number: LS-C757175
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Insulin antibody LS-C757175 is an unconjugated goat polyclonal antibody to human Insulin. Validated for WB.
- Application
- WB
- Predicted Reactivity
- Bov, Can, Ck, Dk, Fel, GP, Gt, Ham, Hr, Hu, Ms, NHP, Por, Rb, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- INS | IRDN | IDDM2 | Preproinsulin | ILPR | Insulin | MODY10 | Proinsulin
- Recommended Dilution: WB
- 1:250 - 1:2000
- UniProt Number
- P01308
- NCBI GenBank
- NM_000207, NP_000198.1
- SwissProt
- P01308
Target
- Target
- Human Insulin
- Antigen Species
- Hu
- Epitope
- Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.
- Gene Name
- INS
Antibody
- Host Species
- Gt
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Recombinant human Insulin (MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN) produced in E. coli as a fusion protein.
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- Supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Short-term store at 2°C to 8°C. Long term store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
