Polyclonal Goat anti-Goat Biotin Antibody (FITC, IF)
Catalog Number: LS-C758060-1
1 mg / $322.00
Antibody: Goat Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunofluorescence
Reactivity: Goat
Format: Liquid
Western blot - Anti-FGFR1 Picoband Antibody
Polyclonal Goat anti-Human FGFR1 / FGF Receptor 1 Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661917-100
Catalog Number: LS-C661917
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FGF Receptor 1 antibody LS-C661917 is an unconjugated goat polyclonal antibody to human FGF Receptor 1 (FGFR1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BFGF receptor | BFGF-R | BFGF-R-1 | CD331 | Cek1 | CD331 antigen | FGFR1 | FGFR1/PLAG1 fusion | FLT2 | Fgf-flg | FGFBR | FGFR-1 | Fms-like tyrosine kinase 2 | HBGFR | HH2 | Hydroxyaryl-protein kinase | FGF receptor 1 | Fms-related tyrosine kinase 2 | Proto-oncogene c-Fgr | BFGFR | CEK | FLT-2 | HBGF receptor | KAL2 | OGD
- UniProt Number
- P11362
- NCBI GenBank
- CAA47375.1 | NM_023110
- SwissProt
- P11362
Target
- Target
- Human FGFR1 / FGF Receptor 1
- Antigen Species
- Human
- Epitope
- Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells. .
- Gene Name
- FGFR1
Antibody
- Host Species
- Goat
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human FGFR1 (489-520 aa FGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
