Western blot analysis of extracts of Raji cells.

POLR2L Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunofluorescence, Immunohistochemistry (general), Western Blot
Reactivity:	Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C335249-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: POLR2L antibody LS-C335249 is an unconjugated rabbit polyclonal antibody to POLR2L from human. It is reactive with mouse and rat. Validated for IF, IHC and WB.
Application: IF, IHC, WB
Reactivity: Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: POLR2L | RBP10 | RPABC5 | RPB10 | RPB7.6 | RPB10 homolog | RPB10beta | HRPB7.6 | HsRPB10b
Recommended Dilution: IF/ICC: 1:50 - 1:200
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P62875
NCBI GenBank: NM_021128 | NP_066951.1
SwissProt: P62875

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)